RBM7 antibody (Middle Region)

Catalog No. ABIN633432

Product Details anti-RBM7 Antibody

Target: RBM7 (RNA Binding Motif Protein 7 (RBM7))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBM7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RBM7 antibody was raised against the middle region of RBM7

Purification: Affinity purified

Immunogen: RBM7 antibody was raised using the middle region of RBM7 corresponding to a region with amino acids SFNQSSSSQWRQGTPSSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBM7 Blocking Peptide, catalog no. 33R-8434, is also available for use as a blocking control in assays to test for specificity of this RBM7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBM7

Target: RBM7 (RNA Binding Motif Protein 7 (RBM7))

Alternative Name: RBM7 (RBM7 Products)

Synonyms: 1200007M24Rik antibody, 1500011D06Rik antibody, AU041934 antibody, AW554393 antibody, RNA binding motif protein 7 antibody, RBM7 antibody, Rbm7 antibody

Background: RBM7 contains 1 RRM (RNA recognition motif) domain. It is possible involved in germ cell RNA processing and meiosis.

Molecular Weight: 30 kDa (MW of target protein)