CELF5 antibody (Middle Region)
-
- Target See all CELF5 Antibodies
- CELF5 (CUGBP, Elav-Like Family Member 5 (CELF5))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CELF5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- BRUNOL5 antibody was raised against the middle region of BRUNOL5
- Purification
- Affinity purified
- Immunogen
- BRUNOL5 antibody was raised using the middle region of BRUNOL5 corresponding to a region with amino acids AFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLP
- Top Product
- Discover our top product CELF5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
BRUNOL5 Blocking Peptide, catalog no. 33R-1175, is also available for use as a blocking control in assays to test for specificity of this BRUNOL5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRUNOL5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CELF5 (CUGBP, Elav-Like Family Member 5 (CELF5))
- Alternative Name
- BRUNOL5 (CELF5 Products)
- Synonyms
- BRUNOL-5 antibody, BRUNOL5 antibody, CELF-5 antibody, 4930565A21Rik antibody, Brunol5 antibody, RGD1565016 antibody, CUGBP Elav-like family member 5 antibody, CUGBP, Elav-like family member 5 antibody, CELF5 antibody, Celf5 antibody
- Background
- Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternatively spliced transcript variants have been identified in this gene.
- Molecular Weight
- 52 kDa (MW of target protein)
-