PRPF8 antibody

Catalog No. ABIN633517

Product Details anti-PRPF8 Antibody

Target: PRPF8 (PRP8 Pre-mRNA Processing Factor 8 (PRPF8))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRPF8 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PRPF8 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRPF8 Blocking Peptide, catalog no. 33R-8515, is also available for use as a blocking control in assays to test for specificity of this PRPF8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPF8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRPF8

Target: PRPF8 (PRP8 Pre-mRNA Processing Factor 8 (PRPF8))

Alternative Name: PRPF8 (PRPF8 Products)

Synonyms: id:ibd1257 antibody, ik:tdsubc_2a9 antibody, im:7141966 antibody, tdsubc_2a9 antibody, wu:fb37c02 antibody, wu:fb73e06 antibody, xx:tdsubc_2a9 antibody, zgc:56504 antibody, hprp8 antibody, prp-8 antibody, prp8 antibody, prpc8 antibody, rp13 antibody, HPRP8 antibody, PRP8 antibody, PRPC8 antibody, RP13 antibody, SNRNP220 antibody, AU019467 antibody, D11Bwg0410e antibody, DBF3/PRP8 antibody, Prp8 antibody, Sfprp8l antibody, pre-mRNA processing factor 8 antibody, pre-mRNA processing factor 8 S homeolog antibody, Prpf8 antibody, prpf8 antibody, prpf8.S antibody, PRPF8 antibody

Background: Pre-mRNA splicing occurs in 2 sequential transesterification steps. PRPF8 is a component of both U2- and U12-dependent spliceosomes, and found to be essential for the catalytic step II in pre-mRNA splicing process. It contains several WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to yeast Prp8 protein. The gene encoding PRPF8 is a candidate gene for autosomal dominant retinitis pigmentosa.Pre-mRNA splicing occurs in 2 sequential transesterification steps.

Molecular Weight: 273 kDa (MW of target protein)