RBM12 antibody (N-Term)

Catalog No. ABIN633604

Product Details anti-RBM12 Antibody

Target: RBM12 (RNA Binding Motif Protein 12 (RBM12))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBM12 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RBM12 antibody was raised against the N terminal of RBM12

Purification: Affinity purified

Immunogen: RBM12 antibody was raised using the N terminal of RBM12 corresponding to a region with amino acids PPPSSGMSSRVNLPTTVSNFNNPSPSVVTATTSVHESNKNIQTFSTASVG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBM12 Blocking Peptide, catalog no. 33R-7271, is also available for use as a blocking control in assays to test for specificity of this RBM12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBM12

Target: RBM12 (RNA Binding Motif Protein 12 (RBM12))

Alternative Name: RBM12 (RBM12 Products)

Synonyms: HRIHFB2091 antibody, SWAN antibody, 5730420G12Rik antibody, 9430070C08Rik antibody, AI852903 antibody, mKIAA0765 antibody, zgc:193560 antibody, zgc:193570 antibody, MGC68861 antibody, hrihfb2091 antibody, DKFZp469A078 antibody, RNA binding motif protein 12 antibody, RNA binding motif protein 12 L homeolog antibody, RBM12 antibody, Rbm12 antibody, rbm12.L antibody, rbm12 antibody, LOC733876 antibody

Background: RBM12 contains several RNA-binding motifs, potential transmembrane domains, and proline-rich regions. The function of RBM12 remains unknown.

Molecular Weight: 97 kDa (MW of target protein)