CLCNKB antibody (N-Term)

Catalog No. ABIN633631

Product Details anti-CLCNKB Antibody

Target: CLCNKB (Chloride Channel Kb (CLCNKB))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CLCNKB antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CLCNKB antibody was raised against the N terminal of CLCNKB

Purification: Affinity purified

Immunogen: CLCNKB antibody was raised using the N terminal of CLCNKB corresponding to a region with amino acids MEEFVGLREGSSGNPVTLQELWGPCPRIRRGIRGGLEWLKQKLFRLGEDW

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CLCNKB Blocking Peptide, catalog no. 33R-5901, is also available for use as a blocking control in assays to test for specificity of this CLCNKB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLCNKB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CLCNKB

Target: CLCNKB (Chloride Channel Kb (CLCNKB))

Alternative Name: CLCNKB (CLCNKB Products)

Synonyms: CLCNKA antibody, CLCNKB antibody, DKFZp469N0132 antibody, CLCKB antibody, Clc-Ka antibody, Clck2 antibody, Clcnk1l antibody, ClC-K2L antibody, ClC-K2 antibody, ClC-Kb antibody, ClC-k antibody, clc-kb antibody, clckb antibody, clcnka-A antibody, clk-k2 antibody, x6clck antibody, xCIC-K antibody, xClC-K antibody, zgc:64141 antibody, Clcnkb antibody, chloride voltage-gated channel Kb antibody, chloride channel Kb antibody, chloride channel, voltage-sensitive Kb antibody, chloride channel, voltage-sensitive Kb L homeolog antibody, chloride channel K antibody, chloride channel protein ClC-Ka antibody, chloride channel protein ClC-Kb antibody, CLCNKB antibody, Clcnkb antibody, clcnkb.L antibody, clcnk antibody, LOC100017912 antibody, LOC100400180 antibody, LOC100590605 antibody, LOC100730738 antibody

Background: Chloride channel Kb (CLCNKB) is a member of the CLC family of voltage-gated chloride channels, which comprises at least 9 mammalian chloride channels. Each is believed to have 12 transmembrane domains and intracellular N and C termini. Mutations in CLCNKB result in the autosomal recessive Type III Bartter Syndrome. CLCNKA and CLCNKB are closely related (94% sequence identity), tightly linked (separated by 11 kb of genomic sequence) and are both expressed in mammalian kidney.

Molecular Weight: 50 kDa (MW of target protein)