SHROOM2 antibody (Middle Region)

Catalog No. ABIN633652

Product Details anti-SHROOM2 Antibody

Target: SHROOM2 (Shroom Family Member 2 (SHROOM2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SHROOM2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SHROOM2 antibody was raised against the middle region of SHROOM2

Purification: Affinity purified

Immunogen: SHROOM2 antibody was raised using the middle region of SHROOM2 corresponding to a region with amino acids CTSPPGLSYMKAKEKTVEDLKSEELAREIVGKDKSLADILDPSVKIKTTM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SHROOM2 Blocking Peptide, catalog no. 33R-1824, is also available for use as a blocking control in assays to test for specificity of this SHROOM2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHROOM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SHROOM2

Target: SHROOM2 (Shroom Family Member 2 (SHROOM2))

Alternative Name: SHROOM2 (SHROOM2 Products)

Synonyms: SHROOM2 antibody, APXL antibody, apxl antibody, shrm2 antibody, HSAPXL antibody, 4832440C16 antibody, Apxl antibody, C630003H05Rik antibody, Shrm2 antibody, shroom family member 2 antibody, SHROOM2 antibody, shroom2 antibody, Shroom2 antibody

Background: SHROOM2 shares significant similarities with the apical protein from Xenopus laevis which is implicated in amiloride-sensitive sodium channel activity. This gene is a strong candidate gene for ocular albinism type 1 syndrome.

Molecular Weight: 176 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Asymmetric Protein Localization