KCNRG antibody (Middle Region)
-
- Target See all KCNRG Antibodies
- KCNRG (Potassium Channel Regulator (KCNRG))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNRG antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCNRG antibody was raised against the middle region of KCNRG
- Purification
- Affinity purified
- Immunogen
- KCNRG antibody was raised using the middle region of KCNRG corresponding to a region with amino acids DTLLKEGFHLVSTRTVSSEDKTECYSFERIKSPEVLITNETPKPETIIIP
- Top Product
- Discover our top product KCNRG Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNRG Blocking Peptide, catalog no. 33R-2198, is also available for use as a blocking control in assays to test for specificity of this KCNRG antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNRG antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNRG (Potassium Channel Regulator (KCNRG))
- Alternative Name
- KCNRG (KCNRG Products)
- Synonyms
- DLTET antibody, Clld4 antibody, E030012H22Rik antibody, Gm745 antibody, putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase antibody, potassium channel regulator antibody, LOC5569660 antibody, KCNRG antibody, Kcnrg antibody
- Background
- KCNRG is a soluble protein with characteristics suggesting it forms heterotetramers with voltage-gated K(+) channels and inhibits their function.
- Molecular Weight
- 31 kDa (MW of target protein)
-