KCNMB4 antibody (Middle Region)
-
- Target See all KCNMB4 Antibodies
- KCNMB4 (Potassium Large Conductance Calcium-Activated Channel, Subfamily M, beta Member 4 (KCNMB4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNMB4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCNMB4 antibody was raised against the middle region of KCNMB4
- Purification
- Affinity purified
- Immunogen
- KCNMB4 antibody was raised using the middle region of KCNMB4 corresponding to a region with amino acids TCGADCRGTSQYPCVQVYVNNSESNSRALLHSDEHQLLTNPKCSYIPPCK
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNMB4 Blocking Peptide, catalog no. 33R-8994, is also available for use as a blocking control in assays to test for specificity of this KCNMB4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNMB4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNMB4 (Potassium Large Conductance Calcium-Activated Channel, Subfamily M, beta Member 4 (KCNMB4))
- Alternative Name
- KCNMB4 (KCNMB4 Products)
- Synonyms
- 1700058G18Rik antibody, 2900045G12Rik antibody, kcnmb4 antibody, potassium calcium-activated channel subfamily M regulatory beta subunit 4 antibody, potassium large conductance calcium-activated channel, subfamily M, beta member 4 antibody, potassium channel subfamily M regulatory beta subunit 4 antibody, Kcnmb4 antibody, KCNMB4 antibody, kcnmb4 antibody
- Background
- KCNMB4 is the regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. KCNMB4 modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. KCNMB4 decreases the gating kinetics and calcium sensitivity of the KCNMA1 channel, but with fast deactivation kinetics. KCNMB4 may decrease KCNMA1 channel openings at low calcium concentrations but increases channel openings at high calcium concentrations. KCNMB4 makes KCNMA1 channel resistant to 100 nM charybdotoxin (CTX) toxin concentrations.
- Molecular Weight
- 24 kDa (MW of target protein)
-