KCNH5 antibody

Catalog No. ABIN633694

Product Details anti-KCNH5 Antibody

Target: KCNH5 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 5 (KCNH5))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNH5 antibody is un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Purification: Affinity purified

Immunogen: KCNH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LTNSRSVLQQLTPMNKTEVVHKHSRLAEVLQLGSDILPQYKQEAPKTPPH

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNH5 Blocking Peptide, catalog no. 33R-5485, is also available for use as a blocking control in assays to test for specificity of this KCNH5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNH5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNH5

Target: KCNH5 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 5 (KCNH5))

Alternative Name: KCNH5 (KCNH5 Products)

Synonyms: EAG2 antibody, H-EAG2 antibody, Kv10.2 antibody, hEAG2 antibody, Eag2 antibody, kcnh5 antibody, si:dkey-100h21.1 antibody, potassium voltage-gated channel subfamily H member 5 antibody, potassium voltage-gated channel, subfamily H (eag-related), member 5 antibody, potassium voltage-gated channel, subfamily H (eag-related), member 5b antibody, potassium voltage-gated channel, subfamily H (eag-related), member 5a antibody, KCNH5 antibody, Kcnh5 antibody, kcnh5b antibody, kcnh5a antibody

Background: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. The KCNH5 gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit of a voltage-gated non-inactivating delayed rectifier potassium channel. KCNH5 is not expressed in differentiating myoblasts.

Molecular Weight: 67 kDa (MW of target protein)