CACNA1I antibody (Middle Region)

Catalog No. ABIN633706

Product Details anti-CACNA1I Antibody

Target: CACNA1I (Calcium Channel, Voltage Dependent, T Type, alpha 1I Subunit (CACNA1I))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CACNA1I antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CACNA1 I antibody was raised against the middle region of CACNA1

Purification: Affinity purified

Immunogen: CACNA1 I antibody was raised using the middle region of CACNA1 corresponding to a region with amino acids LRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWAS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CACNA1I Blocking Peptide, catalog no. 33R-5397, is also available for use as a blocking control in assays to test for specificity of this CACNA1I antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CACNA1I

Target: CACNA1I (Calcium Channel, Voltage Dependent, T Type, alpha 1I Subunit (CACNA1I))

Alternative Name: CACNA1I (CACNA1I Products)

Synonyms: CACNA1L antibody, Ca(V)3.3 antibody, Cav3.3 antibody, ca(v)3.3 antibody, si:ch211-51h13.1 antibody, Ca(v)3.3 antibody, calcium voltage-gated channel subunit alpha1 I antibody, voltage-dependent T-type calcium channel subunit alpha-1I antibody, calcium channel, voltage-dependent, alpha 1I subunit antibody, calcium channel, voltage-dependent, T type, alpha 1I subunit antibody, CACNA1I antibody, LOC100555412 antibody, Cacna1i antibody, cacna1i antibody

Background: Voltage-dependent calcium channels control the rapid entry of Ca(2+) into a variety of cell types and are therefore involved in both electrical and cellular signaling. T-type channels, such as CACNA1I, are activated by small membrane depolarizations and can generate burst firing and pacemaker activity.

Molecular Weight: 245 kDa (MW of target protein)