Mucolipin 3 antibody (Middle Region)

Catalog No. ABIN633713

Product Details anti-Mucolipin 3 Antibody

Target: Mucolipin 3 (Mcoln3)

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Mucolipin 3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Mucolipin 3 antibody was raised against the middle region of MCOLN3

Purification: Affinity purified

Immunogen: Mucolipin 3 antibody was raised using the middle region of MCOLN3 corresponding to a region with amino acids TVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Mucolipin 3 Blocking Peptide, catalog no. 33R-9348, is also available for use as a blocking control in assays to test for specificity of this Mucolipin 3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCOLN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Mucolipin 3

Target: Mucolipin 3 (Mcoln3)

Alternative Name: Mucolipin 3 (Mcoln3 Products)

Synonyms: MCOLN3 antibody, 6720490O21Rik antibody, TRPML3 antibody, Va antibody, TRP-ML3 antibody, trp-ml3 antibody, trpml3 antibody, mucolipin 3 antibody, mucolipin 3 S homeolog antibody, MCOLN3 antibody, mcoln3 antibody, Mcoln3 antibody, mcoln3.S antibody

Background: Mucolipins constitute a family of cation channel proteins with homologs in mouse, Drosophila, and C. elegans. Mutations in the human MCOLN1 gene cause mucolipodosis IV.

Molecular Weight: 64 kDa (MW of target protein)

Pathways: Sensory Perception of Sound