TRPM5 antibody (N-Term)
-
- Target See all TRPM5 Antibodies
- TRPM5 (Transient Receptor Potential Cation Channel, Subfamily M, Member 5 (TRPM5))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TRPM5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TRPM5 antibody was raised against the N terminal of TRPM5
- Purification
- Affinity purified
- Immunogen
- TRPM5 antibody was raised using the N terminal of TRPM5 corresponding to a region with amino acids EKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLERISRAVEQAAPWLILV
- Top Product
- Discover our top product TRPM5 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TRPM5 Blocking Peptide, catalog no. 33R-2505, is also available for use as a blocking control in assays to test for specificity of this TRPM5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPM5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRPM5 (Transient Receptor Potential Cation Channel, Subfamily M, Member 5 (TRPM5))
- Alternative Name
- TRPM5 (TRPM5 Products)
- Synonyms
- LTRPC5 antibody, MTR1 antibody, 9430099A16Rik antibody, LTrpC-5 antibody, Ltrpc5 antibody, Mtr1 antibody, transient receptor potential cation channel subfamily M member 5 antibody, transient receptor potential cation channel, subfamily M, member 5 antibody, TRPM5 antibody, Trpm5 antibody, trpm5 antibody
- Background
- TRPM5 is a voltage-modulated Ca(2+)-activated, monovalent cation channel (VCAM) that mediates a transient membrane depolarization and plays a central role in taste transduction. It is activated by arachidonic acid in vitro. It may be involved in perception of bitter, sweet and umami tastes. It may also be involved in sensing semiochemicals.
- Molecular Weight
- 131 kDa (MW of target protein)
-