GSTM3 antibody

Catalog No. ABIN633805

Product Details anti-GSTM3 Antibody

Target: GSTM3 (Glutathione S-Transferase mu 3 (Brain) (GSTM3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GSTM3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: GSTM3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GSTM3 Blocking Peptide, catalog no. 33R-8636, is also available for use as a blocking control in assays to test for specificity of this GSTM3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTM3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GSTM3

Target: GSTM3 (Glutathione S-Transferase mu 3 (Brain) (GSTM3))

Alternative Name: GSTM3 (GSTM3 Products)

Synonyms: GST5 antibody, GSTB antibody, GSTM3-3 antibody, GTM3 antibody, Fsc2 antibody, mGSTM5 antibody, glutathione S-transferase mu 3 antibody, glutathione S-transferase Mu 3 antibody, glutathione S-transferase, mu 3 antibody, GSTM3 antibody, Gstm3 antibody, LOC479911 antibody

Background: Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. GSTM3 is a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione.

Molecular Weight: 26 kDa (MW of target protein)