Afamin antibody (Middle Region)

Catalog No. ABIN633872

Product Details anti-Afamin Antibody

Target: Afamin (AFM)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Afamin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Afamin antibody was raised against the middle region of AFM

Purification: Affinity purified

Immunogen: Afamin antibody was raised using the middle region of AFM corresponding to a region with amino acids GQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSR

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Afamin Blocking Peptide, catalog no. 33R-3492, is also available for use as a blocking control in assays to test for specificity of this Afamin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AFM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Afamin

Target: Afamin (AFM)

Alternative Name: Afamin (AFM Products)

Synonyms: AFM antibody, ALB2 antibody, ALBA antibody, ALF antibody, Alf antibody, alpha-Alb antibody, afamin antibody, AFM antibody, Afm antibody

Background: AFM is a member of the albumin gene family, which is comprised of four genes that localize to chromosome 4 in a tandem arrangement. These four genes encode structurally-related serum transport proteins that are known to be evolutionarily related. AFM is regulated developmentally, expressed in the liver and secreted into the bloodstream.

Molecular Weight: 69 kDa (MW of target protein)