CBLN4 antibody (C-Term)

Catalog No. ABIN633873

Product Details anti-CBLN4 Antibody

Target: CBLN4 (Cerebellin 4 Precursor (CBLN4))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CBLN4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CBLN4 antibody was raised against the C terminal of CBLN4

Purification: Affinity purified

Immunogen: CBLN4 antibody was raised using the C terminal of CBLN4 corresponding to a region with amino acids HVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CBLN4 Blocking Peptide, catalog no. 33R-3868, is also available for use as a blocking control in assays to test for specificity of this CBLN4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CBLN4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CBLN4

Target: CBLN4 (Cerebellin 4 Precursor (CBLN4))

Alternative Name: CBLN4 (CBLN4 Products)

Synonyms: zgc:172190 antibody, cerebellin-4 antibody, CBLNL1 antibody, AI848962 antibody, cerebellin 4 precursor antibody, cerebellin 4 precursor L homeolog antibody, cerebellin 4 precursor protein antibody, CBLN4 antibody, cbln4 antibody, cbln4.L antibody, Cbln4 antibody

Background: Cerebellin is a sixteen aa peptide found mainly in the adrenal medulla, where it has been shown to have a neuromodulatory function. Cerebellin is derived from precerebellin, a protein with sequence similarity to the noncollagen domain of complement component C1qB. CBLN4 is a glycoprotein which shares sequence similarity with precerebellin.

Molecular Weight: 22 kDa (MW of target protein)