FBLN4 antibody (Middle Region)
-
- Target See all FBLN4 Antibodies
- FBLN4 (Fibulin 4 (FBLN4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FBLN4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EFEMP2 antibody was raised against the middle region of EFEMP2
- Purification
- Affinity purified
- Immunogen
- EFEMP2 antibody was raised using the middle region of EFEMP2 corresponding to a region with amino acids VSAMLVLARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYTF
- Top Product
- Discover our top product FBLN4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EFEMP2 Blocking Peptide, catalog no. 33R-9797, is also available for use as a blocking control in assays to test for specificity of this EFEMP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFEMP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBLN4 (Fibulin 4 (FBLN4))
- Alternative Name
- EFEMP2 (FBLN4 Products)
- Synonyms
- CB257 antibody, fbln4 antibody, fc56c09 antibody, id:ibd2923 antibody, sb:cb257 antibody, wu:fc56c09.x1 antibody, ARCL1B antibody, FBLN4 antibody, MBP1 antibody, UPH1 antibody, 0610011K11Rik antibody, Fbln4 antibody, FIBL-4 antibody, Fibulin-4 antibody, H411 antibody, EGF-containing fibulin-like extracellular matrix protein 2 antibody, EGF containing fibulin-like extracellular matrix protein 2b antibody, fibulin 4 antibody, EGF containing fibulin like extracellular matrix protein 2 antibody, epidermal growth factor-containing fibulin-like extracellular matrix protein 2 antibody, Efemp2 antibody, efemp2b antibody, fbln4 antibody, EFEMP2 antibody
- Background
- A large number of extracellular matrix proteins have been found to contain variations of the epidermal growth factor (EGF) domain and have been implicated in functions as diverse as blood coagulation and activation of complement.
- Molecular Weight
- 49 kDa (MW of target protein)
-