PCCB antibody (Middle Region)
-
- Target See all PCCB Antibodies
- PCCB (Propionyl CoA Carboxylase beta Polypeptide (PCCB))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PCCB antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PCCB antibody was raised against the middle region of PCCB
- Purification
- Affinity purified
- Immunogen
- PCCB antibody was raised using the middle region of PCCB corresponding to a region with amino acids PGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSS
- Top Product
- Discover our top product PCCB Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PCCB Blocking Peptide, catalog no. 33R-7102, is also available for use as a blocking control in assays to test for specificity of this PCCB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCCB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PCCB (Propionyl CoA Carboxylase beta Polypeptide (PCCB))
- Alternative Name
- PCCB (PCCB Products)
- Synonyms
- 1300012P06Rik antibody, AI314687 antibody, R74805 antibody, propionyl-CoA carboxylase beta subunit antibody, propionyl Coenzyme A carboxylase, beta polypeptide antibody, PCCB antibody, Pccb antibody
- Background
- PCCB is a subunit of the propionyl-CoA carboxylase (PCC) enzyme, which is involved in the catabolism of propionyl-CoA. PCC is a mitochondrial enzyme that probably acts as a dodecamer of six alpha subunits and six beta subunits. Defects in this gene are a cause of propionic acidemia type II (PA-2).
- Molecular Weight
- 58 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-