B3GALNT2 antibody (Middle Region)
-
- Target See all B3GALNT2 Antibodies
- B3GALNT2 (beta-1,3-N-Acetylgalactosaminyl Transferase 2 (B3GALNT2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This B3GALNT2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- B3 GALNT2 antibody was raised against the middle region of B3 ALNT2
- Purification
- Affinity purified
- Immunogen
- B3 GALNT2 antibody was raised using the middle region of B3 ALNT2 corresponding to a region with amino acids PESFEGTIVWESQDLHGLVSRNLHKVTVNDGGGVLRVITAGEGALPHEFL
- Top Product
- Discover our top product B3GALNT2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
B3GALNT2 Blocking Peptide, catalog no. 33R-7062, is also available for use as a blocking control in assays to test for specificity of this B3GALNT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALNT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- B3GALNT2 (beta-1,3-N-Acetylgalactosaminyl Transferase 2 (B3GALNT2))
- Alternative Name
- B3GALNT2 (B3GALNT2 Products)
- Synonyms
- B3GalNAc-T2 antibody, MDDGA11 antibody, RGD1306946 antibody, zgc:112351 antibody, A930105D20Rik antibody, C80633 antibody, D230016N13Rik antibody, beta-1,3-N-acetylgalactosaminyltransferase 2 antibody, beta-1,3-N-acetylgalactosaminyltransferase 2 L homeolog antibody, UDP-GalNAc:betaGlcNAc beta 1,3-galactosaminyltransferase, polypeptide 2 antibody, B3GALNT2 antibody, b3galnt2 antibody, B3galnt2 antibody, b3galnt2.L antibody
- Background
- B3GALNT2 is the beta-1,3-N-acetylgalactosaminyltransferase active in synthesizing a unique carbohydrate structure, GalNAc-beta-1-3GlcNAc, on N- and O-glycans. B3GALNT2 has no galactose nor galactosaminyl transferase activity toward any acceptor substrate.
- Molecular Weight
- 57 kDa (MW of target protein)
-