PYCR1 antibody (Middle Region)

Catalog No. ABIN633951

Product Details anti-PYCR1 Antibody

Target: PYCR1 (Pyrroline-5-Carboxylate Reductase 1 (PYCR1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PYCR1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PYCR1 antibody was raised against the middle region of PYCR1

Purification: Affinity purified

Immunogen: PYCR1 antibody was raised using the middle region of PYCR1 corresponding to a region with amino acids RSLLINAVEASCIRTRELQSMADQEQVSPAAIKKTILDKDHLPLELGSPE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PYCR1 Blocking Peptide, catalog no. 33R-8196, is also available for use as a blocking control in assays to test for specificity of this PYCR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PYCR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PYCR1

Target: PYCR1 (Pyrroline-5-Carboxylate Reductase 1 (PYCR1))

Alternative Name: PYCR1 (PYCR1 Products)

Synonyms: arcl2b antibody, p5c antibody, p5cr antibody, pig45 antibody, pp222 antibody, pro3 antibody, pycr antibody, ARCL2B antibody, ARCL3B antibody, P5C antibody, P5CR antibody, PIG45 antibody, PP222 antibody, PRO3 antibody, PYCR antibody, zgc:73112 antibody, pyrroline-5-carboxylate reductase family, member 1 L homeolog antibody, pyrroline-5-carboxylate reductase 1 antibody, pyrroline-5-carboxylate reductase 1a antibody, pycr1.L antibody, PYCR1 antibody, Pycr1 antibody, pycr1a antibody

Background: This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types.

Molecular Weight: 33 kDa (MW of target protein)