PLG antibody (Middle Region)

Catalog No. ABIN633957

Product Details anti-PLG Antibody

Target: PLG (Plasminogen (PLG))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PLG antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Plasminogen antibody was raised against the middle region of PLG

Purification: Affinity purified

Immunogen: Plasminogen antibody was raised using the middle region of PLG corresponding to a region with amino acids LISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Plasminogen Blocking Peptide, catalog no. 33R-5066, is also available for use as a blocking control in assays to test for specificity of this Plasminogen antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

References for anti-PLG antibody (ABIN633957)

Giraud, Chabaud, Lejeune, Barbaria, Mallet: "The plasminogen-like molecule apically secreted by epithelial thyroid cells is sulfated." in: Biochemical and biophysical research communications, Vol. 346, Issue 3, pp. 746-50, (2006) (PubMed).

Giraud, Dicristofaro, De Micco, Lejeune, Barbaria, Mallet: "A plasminogen-like protein, present in the apical extracellular environment of thyroid epithelial cells, degrades thyroglobulin in vitro." in: Biochemical and biophysical research communications, Vol. 338, Issue 2, pp. 1000-4, (2005) (PubMed).

Target Details for PLG

Target: PLG (Plasminogen (PLG))

Alternative Name: Plasminogen (PLG Products)

Synonyms: wu:fb70e09 antibody, PLG antibody, LPA antibody, plg antibody, Ab1-346 antibody, AI649309 antibody, Pg antibody, plasminogen antibody, plg antibody, PLG antibody, Plg antibody

Background: The protein encoded by this gene is a secreted blood zymogen that is activated by proteolysis and converted to plasmin and angiostatin.

Molecular Weight: 88 kDa (MW of target protein)

Pathways: Complement System, Lipid Metabolism