Plexin A4 antibody (Middle Region)

Catalog No. ABIN633960

Product Details anti-Plexin A4 Antibody

Target: Plexin A4 (PLXNA4)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Plexin A4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Plexin A4 antibody was raised against the middle region of PLXNA4

Purification: Affinity purified

Immunogen: Plexin A4 antibody was raised using the middle region of PLXNA4 corresponding to a region with amino acids TQEWIGVEGDPPGANIASQEQMLCVYLQCSSHKAISDQRVQPLLCCFLNV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Plexin A4 Blocking Peptide, catalog no. 33R-9241, is also available for use as a blocking control in assays to test for specificity of this Plexin A4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLXNA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Plexin A4

Target: Plexin A4 (PLXNA4)

Alternative Name: Plexin A4 (PLXNA4 Products)

Synonyms: D204 antibody, wu:fd49b01 antibody, wu:fe15f03 antibody, PLXNA4A antibody, FAYV2820 antibody, PLEXA4 antibody, PLXNA4B antibody, PRO34003 antibody, 9330117B14 antibody, Plxa4 antibody, mKIAA1550 antibody, PLEX2 antibody, Plxna4 antibody, PLXNA4 antibody, plexin A4 antibody, plexin-A4 antibody, plxna4 antibody, PLXNA4 antibody, LOC100467706 antibody, Plxna4 antibody

Background: This protein mediates semaphorin receptor activity.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Regulation of Cell Size