ENPP6 antibody (Middle Region)
-
- Target See all ENPP6 Antibodies
- ENPP6 (Ectonucleotide pyrophosphatase/phosphodiesterase 6 (ENPP6))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ENPP6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ENPP6 antibody was raised against the middle region of ENPP6
- Purification
- Affinity purified
- Immunogen
- ENPP6 antibody was raised using the middle region of ENPP6 corresponding to a region with amino acids ELMDMRGIFLAFGPDFKSNFRAAPIRSVDVYNVMCNVVGITPLPNNGSWS
- Top Product
- Discover our top product ENPP6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ENPP6 Blocking Peptide, catalog no. 33R-2561, is also available for use as a blocking control in assays to test for specificity of this ENPP6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENPP6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ENPP6 (Ectonucleotide pyrophosphatase/phosphodiesterase 6 (ENPP6))
- Alternative Name
- ENPP6 (ENPP6 Products)
- Synonyms
- E-NPP 6 antibody, cb1028 antibody, sb:cb727 antibody, zgc:103605 antibody, NPP6 antibody, NPP-6 antibody, 4833421B01Rik antibody, B830047L21Rik antibody, D8Ertd514e antibody, Npp6 antibody, E-NPP6 antibody, ectonucleotide pyrophosphatase/phosphodiesterase 6 antibody, ectonucleotide pyrophosphatase/phosphodiesterase 6 L homeolog antibody, enpp6 antibody, enpp6.L antibody, ENPP6 antibody, Enpp6 antibody
- Background
- ENPP6 is a choline-specific glycerophosphodiester phosphodiesterase. ENPP6 hydrolyzes the classical substrate for phospholipase C, p-nitrophenyl phosphorylcholine, while it does not hydrolyze the classical nucleotide phosphodiesterase substrate, p-nitrophenyl thymidine 5'-monophosphate.
- Molecular Weight
- 50 kDa (MW of target protein)
-