PLOD2 antibody (Middle Region)

Catalog No. ABIN634011

Product Details anti-PLOD2 Antibody

Target: PLOD2 (Procollagen-Lysine 2-Oxoglutarate 5-Dioxygenase 2 (PLOD2))

Binding Specificity: Middle Region

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PLOD2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PLOD2 antibody was raised against the middle region of PLOD2

Purification: Affinity purified

Immunogen: PLOD2 antibody was raised using the middle region of PLOD2 corresponding to a region with amino acids IKGKTLRSEMNERNYFVRDKLDPDMALCRNAREMTLQREKDSPTPETFQM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PLOD2 Blocking Peptide, catalog no. 33R-4019, is also available for use as a blocking control in assays to test for specificity of this PLOD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLOD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PLOD2

Target: PLOD2 (Procollagen-Lysine 2-Oxoglutarate 5-Dioxygenase 2 (PLOD2))

Alternative Name: PLOD2 (PLOD2 Products)

Synonyms: D530025C14Rik antibody, LH2 antibody, Plod-2 antibody, TLH antibody, procollagen lysine, 2-oxoglutarate 5-dioxygenase 2 antibody, procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 antibody, Plod2 antibody, PLOD2 antibody

Background: PLOD2 forms hydroxylysine residues in -Xaa-Lys-Gly- sequences in collagens. These hydroxylysines serve as sites of attachment for carbohydrate units and are essential for the stability of the intermolecular collagen cross-links.

Molecular Weight: 84 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome