Glutaminase antibody (Middle Region)

Catalog No. ABIN634050

Product Details anti-Glutaminase Antibody

Target: Glutaminase (GLS)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Glutaminase antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GLS antibody was raised against the middle region of GLS

Purification: Affinity purified

Immunogen: GLS antibody was raised using the middle region of GLS corresponding to a region with amino acids VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GLS Blocking Peptide, catalog no. 33R-9711, is also available for use as a blocking control in assays to test for specificity of this GLS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Glutaminase

Target: Glutaminase (GLS)

Alternative Name: GLS (GLS Products)

Synonyms: Glut antibody, RATGLUT antibody, gls antibody, si:dz87i4.2 antibody, wu:fa97e05 antibody, GA antibody, PAG antibody, AAD20 antibody, GAC antibody, GAM antibody, GLS1 antibody, KGA antibody, AI314027 antibody, 6330442B14 antibody, B230365M23Rik antibody, CG8772 antibody, CG8872 antibody, Dmel\\CG42708 antibody, Dmel_CG8772 antibody, BA3155 antibody, glutaminase antibody, glutaminase b antibody, Glutaminase antibody, glutaminase kidney isoform, mitochondrial antibody, Gls antibody, GLS antibody, gls antibody, glsb antibody, glsA2 antibody, glsA-2 antibody, Arnit_3113 antibody, Celal_2913 antibody, Celly_0289 antibody, Weevi_2101 antibody, Mesop_4683 antibody, LOC100069617 antibody

Background: Sahai demonstrated phosphate-activated glutaminase in human platelets. It is the major enzyme yielding glutamate from glutamine.

Molecular Weight: 73 kDa (MW of target protein)

Pathways: Feeding Behaviour, Dicarboxylic Acid Transport, Warburg Effect