SMC4 antibody (Middle Region)

Catalog No. ABIN634091

Product Details anti-SMC4 Antibody

Target: SMC4 (Structural Maintenance of Chromosomes 4 (SMC4))

Binding Specificity: Middle Region

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SMC4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SMC4 antibody was raised against the middle region of SMC4

Purification: Affinity purified

Immunogen: SMC4 antibody was raised using the middle region of SMC4 corresponding to a region with amino acids EARCHEMKPNLGAIAEYKKKEELYLQRVAELDKITYERDSFRQAYEDLRK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SMC4 Blocking Peptide, catalog no. 33R-2280, is also available for use as a blocking control in assays to test for specificity of this SMC4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SMC4

Target: SMC4 (Structural Maintenance of Chromosomes 4 (SMC4))

Alternative Name: SMC4 (SMC4 Products)

Synonyms: CAP-C antibody, CAPC antibody, SMC-4 antibody, SMC4L1 antibody, hCAP-C antibody, 2500002A22Rik antibody, C79747 antibody, Smc4l1 antibody, cb788 antibody, chunp6901 antibody, fb99b10 antibody, smc4l1 antibody, wu:fb99b10 antibody, xcap-c antibody, ARABIDOPSIS THALIANA CHROMOSOME ASSOCIATED PROTEIN-C antibody, ARABIDOPSIS THALIANA STRUCTURAL MAINTENANCE OF CHROMOSOME 4 antibody, ATCAP-C antibody, ATSMC3 antibody, ATSMC4 antibody, K15N18.7 antibody, K15N18_7 antibody, STRUCTURAL MAINTENANCE OF CHROMOSOMES 3 antibody, structural maintenance of chromosome 3 antibody, Structural maintenance of chromosomes protein 4 antibody, structural maintenance of chromosomes 4 antibody, structural maintenance of chromosomes 4 L homeolog antibody, structural maintenance of chromosome 3 antibody, smc-4 antibody, SMC4 antibody, Smc4 antibody, smc4 antibody, smc4.L antibody, SMC3 antibody

Background: SMC4 is the central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.

Molecular Weight: 147 kDa (MW of target protein)