HERC5 antibody (Middle Region)

Catalog No. ABIN634098

Product Details anti-HERC5 Antibody

Target: HERC5 (Hect Domain and RLD 5 (HERC5))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HERC5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HERC5 antibody was raised against the middle region of HERC5

Purification: Affinity purified

Immunogen: HERC5 antibody was raised using the middle region of HERC5 corresponding to a region with amino acids FHPEELKDVIVGNTDYDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HERC5 Blocking Peptide, catalog no. 33R-2921, is also available for use as a blocking control in assays to test for specificity of this HERC5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HERC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HERC5

Target: HERC5 (Hect Domain and RLD 5 (HERC5))

Alternative Name: HERC5 (HERC5 Products)

Synonyms: HERC5 antibody, CEB1 antibody, CEBP1 antibody, HECT and RLD domain containing E3 ubiquitin protein ligase 5 antibody, hect domain and RLD 5 antibody, HERC5 antibody

Background: This gene is a member of the HERC family of ubiquitin ligases and encodes a protein with a HECT domain and five RCC1 repeats. Pro-inflammatory cytokines upregulate expression of this gene in endothelial cells. The protein localizes to the cytoplasm and perinuclear region and functions as an interferon-induced E3 protein ligase that mediates ISGylation of protein targets. The gene lies in a cluster of HERC family genes on chromosome 4.

Molecular Weight: 117 kDa (MW of target protein)