KIF15 antibody (Middle Region)
-
- Target See all KIF15 Antibodies
- KIF15 (Kinesin Family Member 15 (KIF15))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KIF15 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KIF15 antibody was raised against the middle region of KIF15
- Purification
- Affinity purified
- Immunogen
- KIF15 antibody was raised using the middle region of KIF15 corresponding to a region with amino acids SKKHSGLLQSAQEELTKKEALIQELQHKLNQKKEEVEQKKNEYNFKMRQL
- Top Product
- Discover our top product KIF15 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KIF15 Blocking Peptide, catalog no. 33R-8556, is also available for use as a blocking control in assays to test for specificity of this KIF15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIF15 (Kinesin Family Member 15 (KIF15))
- Alternative Name
- KIF15 (KIF15 Products)
- Synonyms
- XKlp2 antibody, kif15 antibody, klp2 antibody, KIF15 antibody, si:dkey-108k21.1 antibody, wu:fb96c12 antibody, wu:fc51g12 antibody, wu:fe01e02 antibody, HKLP2 antibody, KNSL7 antibody, NY-BR-62 antibody, 3110023M17Rik antibody, 3930402I10Rik antibody, D330038N01 antibody, Knsl7 antibody, b2b1117.1Clo antibody, kinesin family member 15 L homeolog antibody, kinesin family member 15 antibody, kinesin family member 15 S homeolog antibody, zinc finger protein 660 antibody, kif15.L antibody, KIF15 antibody, kif15.S antibody, kif15 antibody, Kif15 antibody, ZNF660 antibody
- Background
- KIF15 is the plus-end directed kinesin-like motor enzyme involved in mitotic spindle assembly.
- Molecular Weight
- 160 kDa (MW of target protein)
-