CDK5RAP1 antibody (N-Term)

Catalog No. ABIN634233

Product Details anti-CDK5RAP1 Antibody

Target: CDK5RAP1 (CDK5 Regulatory Subunit Associated Protein 1 (CDK5RAP1))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CDK5RAP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CDK5 RAP1 antibody was raised against the N terminal of CDK5 AP1

Purification: Affinity purified

Immunogen: CDK5 RAP1 antibody was raised using the N terminal of CDK5 AP1 corresponding to a region with amino acids MMDELLGRQRKVYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDK5RAP1 Blocking Peptide, catalog no. 33R-6227, is also available for use as a blocking control in assays to test for specificity of this CDK5RAP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDK0 AP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CDK5RAP1

Target: CDK5RAP1 (CDK5 Regulatory Subunit Associated Protein 1 (CDK5RAP1))

Alternative Name: CDK5RAP1 (CDK5RAP1 Products)

Synonyms: cdk5rap1 antibody, MGC154823 antibody, C20orf34 antibody, C42 antibody, CGI-05 antibody, HSPC167 antibody, 2310066P17Rik antibody, CDK5 regulatory subunit associated protein 1 antibody, CDK5 regulatory subunit associated protein 1 L homeolog antibody, CDK5RAP1 antibody, cdk5rap1 antibody, cdk5rap1.L antibody, Cdk5rap1 antibody

Background: Neuronal CDC2-like kinase, which is involved in the regulation of neuronal differentiation, is composed of a catalytic subunit, CDK5, and an activating subunit, p25NCK5A.

Molecular Weight: 55 kDa (MW of target protein)