KIF13B antibody (N-Term)

Catalog No. ABIN634243

Product Details anti-KIF13B Antibody

Target: KIF13B (Kinesin Family Member 13B (KIF13B))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KIF13B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KIF13 B antibody was raised against the N terminal of KIF13

Purification: Affinity purified

Immunogen: KIF13 B antibody was raised using the N terminal of KIF13 corresponding to a region with amino acids SGKSYTMMGTADQPGLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIF13B Blocking Peptide, catalog no. 33R-8472, is also available for use as a blocking control in assays to test for specificity of this KIF13B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KIF13B

Target: KIF13B (Kinesin Family Member 13B (KIF13B))

Alternative Name: KIF13B (KIF13B Products)

Synonyms: kif13b antibody, xKIF13b antibody, GAKIN antibody, 5330429L19Rik antibody, 6030414C01 antibody, AI429803 antibody, C130021D12Rik antibody, kinesin family member 13Ba antibody, kinesin family member 13B L homeolog antibody, kinesin family member 13B antibody, kif13ba antibody, kif13b.L antibody, KIF13B antibody, Kif13b antibody

Background: KIF13B may be involved in reorganization of the cortical cytoskeleton. KIF13B may be functionally important for the intracellular trafficking of MAGUKs and associated protein complexes.

Molecular Weight: 203 kDa (MW of target protein)