SLC12A4 antibody
-
- Target See all SLC12A4 Antibodies
- SLC12A4 (Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 4 (SLC12A4))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC12A4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC12 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFL
- Top Product
- Discover our top product SLC12A4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC12A4 Blocking Peptide, catalog no. 33R-6285, is also available for use as a blocking control in assays to test for specificity of this SLC12A4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC12A4 (Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 4 (SLC12A4))
- Alternative Name
- SLC12A4 (SLC12A4 Products)
- Synonyms
- KCC1 antibody, kcc1 antibody, SLC12A4 antibody, AW546649 antibody, RBCKCC1 antibody, Kcc1 antibody, solute carrier family 12 member 4 antibody, solute carrier family 12 (potassium/chloride transporter), member 4 L homeolog antibody, solute carrier family 12, member 4 antibody, SLC12A4 antibody, slc12a4.L antibody, Slc12a4 antibody
- Background
- SLC12A4 mediates electroneutral potassium-chloride cotransport when activated by cell swelling. SLC12A4 may contribute to cell volume homeostasis in single cells.
- Molecular Weight
- 121 kDa (MW of target protein)
-