RFT1 antibody

Catalog No. ABIN634279

Product Details anti-RFT1 Antibody

Target: RFT1 (RFT1 Homolog (RFT1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RFT1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RFT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTQRDWSQTLNLLWLTVPLGVFWSLFLGWIWLQLLEVPDPNVVPHYATGV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RFT1 Blocking Peptide, catalog no. 33R-3615, is also available for use as a blocking control in assays to test for specificity of this RFT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RFT1

Target: RFT1 (RFT1 Homolog (RFT1))

Alternative Name: RFT1 (RFT1 Products)

Synonyms: GB14370 antibody, CDG1N antibody, D930025H04 antibody, RGD1562654 antibody, protein RFT1 homolog antibody, RFT1 homolog antibody, LOC412489 antibody, LOC100453537 antibody, RFT1 antibody, rft1 antibody, LOC100633251 antibody, LOC100651701 antibody, Rft1 antibody

Background: N-glycosylation of proteins follows a highly conserved pathway that begins with the synthesis of aMan(5)GlcNAc(2)-dolichylpyrophosphate (PP-Dol) intermediate on the cytoplasmic side of the endoplasmic reticulum (ER) membrane followed by the translocation of Man(5)GlcNAc (2)-PP-Dol to the luminal side of the ER membrane. RFT1 is the flippase enzyme that catalyzes this translocation.

Molecular Weight: 60 kDa (MW of target protein)