DGKH antibody (Middle Region)

Catalog No. ABIN634333

Product Details anti-DGKH Antibody

Target: DGKH (Diacylglycerol Kinase, eta (DGKH))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DGKH antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DGKH antibody was raised against the middle region of DGKH

Purification: Affinity purified

Immunogen: DGKH antibody was raised using the middle region of DGKH corresponding to a region with amino acids EPANQSSDYDSTETDESKEEAKDDGAKESITVKTAPRSPDARASYGHSQT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DGKH Blocking Peptide, catalog no. 33R-2623, is also available for use as a blocking control in assays to test for specificity of this DGKH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGKH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DGKH

Target: DGKH (Diacylglycerol Kinase, eta (DGKH))

Alternative Name: DGKH (DGKH Products)

Synonyms: DGKeta antibody, 5930402B05Rik antibody, D130015C16 antibody, DGKH antibody, RGD1561955 antibody, si:ch211-93a19.1 antibody, diacylglycerol kinase eta antibody, diacylglycerol kinase, eta antibody, DGKH antibody, Dgkh antibody, LOC100546131 antibody, dgkh antibody

Background: DGKH is a member of the diacylglycerol kinase (DGK) enzyme family of proteins, specifically the type II DGK subfamily. Members of this family are involved in regulating the intracellular concentrations of diacylglycerol and phosphatidic acid.

Molecular Weight: 135 kDa (MW of target protein)