RAB27A antibody (Middle Region)

Catalog No. ABIN634343

Product Details anti-RAB27A Antibody

Target: RAB27A (RAB27A, Member RAS Oncogene Family (RAB27A))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB27A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RAB27 A antibody was raised against the middle region of RAB27

Purification: Affinity purified

Immunogen: RAB27 A antibody was raised using the middle region of RAB27 corresponding to a region with amino acids SQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAB27A Blocking Peptide, catalog no. 33R-8704, is also available for use as a blocking control in assays to test for specificity of this RAB27A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAB27A

Target: RAB27A (RAB27A, Member RAS Oncogene Family (RAB27A))

Alternative Name: RAB27A (RAB27A Products)

Synonyms: MGC80943 antibody, RAB27A antibody, gs2 antibody, ram antibody, rab27 antibody, MGC89827 antibody, hst18676 antibody, zgc:114135 antibody, GS2 antibody, HsT18676 antibody, RAB27 antibody, RAM antibody, 2210402C08Rik antibody, 2410003M20Rik antibody, 4933437C11Rik antibody, ash antibody, RAB27A, member RAS oncogene family L homeolog antibody, RAB27A, member RAS oncogene family antibody, RAB27A, member RAS oncogene family S homeolog antibody, rab27a.L antibody, RAB27A antibody, rab27a antibody, rab27a.S antibody, Rab27a antibody

Background: The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism