MAP4K5 antibody (Middle Region)

Catalog No. ABIN634353

Product Details anti-MAP4K5 Antibody

Target: MAP4K5 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 5 (MAP4K5))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAP4K5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MAP4 K5 antibody was raised against the middle region of MAP4 5

Purification: Affinity purified

Immunogen: MAP4 K5 antibody was raised using the middle region of MAP4 5 corresponding to a region with amino acids QGKSFKSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPTAHSNLYILA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAP4K5 Blocking Peptide, catalog no. 33R-7562, is also available for use as a blocking control in assays to test for specificity of this MAP4K5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAP4K5

Target: MAP4K5 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 5 (MAP4K5))

Alternative Name: MAP4K5 (MAP4K5 Products)

Synonyms: GCKR antibody, KHS antibody, KHS1 antibody, MAPKKKK5 antibody, 4432415E19Rik antibody, RGD1562028 antibody, fl74c10 antibody, wu:fl74c10 antibody, zgc:55719 antibody, zgc:55985 antibody, mitogen-activated protein kinase kinase kinase kinase 5 antibody, mitogen-activated protein kinase kinase kinase kinase 5 S homeolog antibody, MAP4K5 antibody, Map4k5 antibody, map4k5 antibody, map4k5.S antibody

Background: MAP4K5 may play a role in the response to environmental stress. Appears to act upstream of the JUN N-terminal pathway.

Molecular Weight: 95 kDa (MW of target protein)