DDAH2 antibody (N-Term)

Catalog No. ABIN634365

Product Details anti-DDAH2 Antibody

Target: DDAH2 (Dimethylarginine Dimethylaminohydrolase 2 (DDAH2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDAH2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DDAH2 antibody was raised against the N terminal of DDAH2

Purification: Affinity purified

Immunogen: DDAH2 antibody was raised using the N terminal of DDAH2 corresponding to a region with amino acids MYTLHTKRVKAAARQMWTSNLSKVRQSLKNVYHKCKIRHQDSTGYPTVTS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDAH2 Blocking Peptide, catalog no. 33R-6631, is also available for use as a blocking control in assays to test for specificity of this DDAH2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDAH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDAH2

Target: DDAH2 (Dimethylarginine Dimethylaminohydrolase 2 (DDAH2))

Alternative Name: DDAH2 (DDAH2 Products)

Synonyms: ddah2 antibody, MGC84290 antibody, g6a antibody, ddah antibody, ng30 antibody, ddahii antibody, MGC89103 antibody, DDAH2 antibody, DDAH antibody, DDAHII antibody, G6a antibody, NG30 antibody, 1110003M04Rik antibody, AU019324 antibody, AW413173 antibody, DDAH-2 antibody, Ddah antibody, dimethylarginine dimethylaminohydrolase 2 antibody, dimethylarginine dimethylaminohydrolase 2 L homeolog antibody, ddah2 antibody, ddah2.L antibody, DDAH2 antibody, Ddah2 antibody

Background: DDAH2 hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. DDAH2 has therefore a role in nitric oxide generation.

Molecular Weight: 31 kDa (MW of target protein)