RAB18 antibody (C-Term)

Catalog No. ABIN634369

Product Details anti-RAB18 Antibody

Target: RAB18 (RAB18, Member RAS Oncogene Family (RAB18))

Binding Specificity: C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB18 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RAB18 antibody was raised against the C terminal of RAB18

Purification: Affinity purified

Immunogen: RAB18 antibody was raised using the C terminal of RAB18 corresponding to a region with amino acids LFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAB18 Blocking Peptide, catalog no. 33R-4939, is also available for use as a blocking control in assays to test for specificity of this RAB18 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAB18

Target: RAB18 (RAB18, Member RAS Oncogene Family (RAB18))

Alternative Name: RAB18 (RAB18 Products)

Synonyms: RAB18LI1 antibody, WARBM3 antibody, AA959686 antibody, RAB18 antibody, rab18li1 antibody, LOC100219058 antibody, rab18 antibody, zgc:92523 antibody, fc62e07 antibody, wu:fc62e07 antibody, zgc:77145 antibody, RAB18, member RAS oncogene family antibody, ras-related protein Rab-18-B antibody, ras-related protein Rab-18-like antibody, Ras-related protein Rab-18 antibody, RAB18, member RAS oncogene family S homeolog antibody, RAB18B, member RAS oncogene family antibody, RAB18A, member RAS oncogene family antibody, RAB18 antibody, Rab18 antibody, rab18 antibody, LOC100219058 antibody, rab-18 antibody, rab18.S antibody, rab18b antibody, rab18a antibody

Background: RAB18 belongs to the small GTPase superfamily.

Molecular Weight: 23 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome