RGS11 antibody (Middle Region)
-
- Target See all RGS11 Antibodies
- RGS11 (Regulator of G-Protein Signaling 11 (RGS11))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RGS11 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RGS11 antibody was raised against the middle region of RGS11
- Purification
- Affinity purified
- Immunogen
- RGS11 antibody was raised using the middle region of RGS11 corresponding to a region with amino acids LRQPHRYVLDDAQLHIYMLMKKDSYPRFLKSDMYKALLAEAGIPLEMKRR
- Top Product
- Discover our top product RGS11 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RGS11 Blocking Peptide, catalog no. 33R-5382, is also available for use as a blocking control in assays to test for specificity of this RGS11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RGS11 (Regulator of G-Protein Signaling 11 (RGS11))
- Alternative Name
- RGS11 (RGS11 Products)
- Synonyms
- RS11 antibody, C78048 antibody, XRGSIV antibody, rgs9-a antibody, regulator of G protein signaling 11 antibody, regulator of G-protein signaling 11 antibody, regulator of G-protein signaling 11 L homeolog antibody, RGS11 antibody, Rgs11 antibody, rgs11.L antibody
- Background
- RGS11 belongs to the RGS (regulator of G protein signaling) family. Members of the RGS family act as GTPase-activating proteins on the alpha subunits of heterotrimeric, signal-transducing G proteins. This protein inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form.
- Molecular Weight
- 51 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling
-