RAB39B antibody (N-Term)

Catalog No. ABIN634406

Product Details anti-RAB39B Antibody

Target: RAB39B (RAB39B, Member RAS Oncogene Family (RAB39B))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB39B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RAB39 B antibody was raised against the N terminal of RAB39

Purification: Affinity purified

Immunogen: RAB39 B antibody was raised using the N terminal of RAB39 corresponding to a region with amino acids MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAB39B Blocking Peptide, catalog no. 33R-5891, is also available for use as a blocking control in assays to test for specificity of this RAB39B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAB39B

Target: RAB39B (RAB39B, Member RAS Oncogene Family (RAB39B))

Alternative Name: RAB39B (RAB39B Products)

Synonyms: RAB39B antibody, LOC100221662 antibody, zgc:153068 antibody, MRX72 antibody, 6330580M05Rik antibody, RAB39B, member RAS oncogene family antibody, RAB39B, member RAS oncogene family a antibody, RAB39B, member RAS oncogene family b antibody, RAB39B antibody, rab39ba antibody, rab39bb antibody, Rab39b antibody

Background: RAB39B may be involved in vesicular trafficking.

Molecular Weight: 24 kDa (MW of target protein)