TP53TG5 antibody (Middle Region)
-
- Target See all TP53TG5 Antibodies
- TP53TG5 (TP53 Target 5 (TP53TG5))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TP53TG5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C20 ORF10 antibody was raised against the middle region of C20 rf10
- Purification
- Affinity purified
- Immunogen
- C20 ORF10 antibody was raised using the middle region of C20 rf10 corresponding to a region with amino acids TSLAAMPRKEKHIEPEVPRTSRDDSLNPGVQGRQPLTEGPRVIFIKPYRN
- Top Product
- Discover our top product TP53TG5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C20ORF10 Blocking Peptide, catalog no. 33R-9289, is also available for use as a blocking control in assays to test for specificity of this C20ORF10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TP53TG5 (TP53 Target 5 (TP53TG5))
- Alternative Name
- C20ORF10 (TP53TG5 Products)
- Synonyms
- TP53TG5 antibody, C20orf10 antibody, CLG01 antibody, TP53 target 5 antibody, TP53TG5 antibody
- Background
- C20orf10 may play a significant role in p53/TP53-mediating signaling pathway.
- Molecular Weight
- 32 kDa (MW of target protein)
-