ASB6 antibody (Middle Region)

Catalog No. ABIN634452

Product Details anti-ASB6 Antibody

Target: ASB6 (Ankyrin Repeat and SOCS Box Containing 6 (ASB6))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ASB6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ASB6 antibody was raised against the middle region of ASB6

Purification: Affinity purified

Immunogen: ASB6 antibody was raised using the middle region of ASB6 corresponding to a region with amino acids LKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ASB6 Blocking Peptide, catalog no. 33R-5090, is also available for use as a blocking control in assays to test for specificity of this ASB6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASB6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ASB6

Target: ASB6 (Ankyrin Repeat and SOCS Box Containing 6 (ASB6))

Alternative Name: ASB6 (ASB6 Products)

Synonyms: zgc:110231 antibody, 2510004M11Rik antibody, AA409356 antibody, ankyrin repeat and SOCS box containing 6 antibody, ankyrin repeat and SOCS box containing 6 S homeolog antibody, ankyrin repeat and SOCS box-containing 6 antibody, asb6 antibody, asb6.S antibody, ASB6 antibody, Asb6 antibody

Background: ASB6 belongs to a family of ankyrin repeat proteins that, along with four other protein families, contain a C-terminal SOCS box motif. Growing evidence suggests that the SOCS box, similar to the F-box, acts as a bridge between specific substrate-binding domains and the more generic proteins that comprise a large family of E3 ubiquitin protein ligases.

Molecular Weight: 46 kDa (MW of target protein)