PF4V1 antibody (Middle Region)

Catalog No. ABIN634485

Product Details anti-PF4V1 Antibody

Target: PF4V1 (Platelet Factor 4 Variant 1 (PF4V1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PF4V1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PF4 V1 antibody was raised against the middle region of PF4 1

Purification: Affinity purified

Immunogen: PF4 V1 antibody was raised using the middle region of PF4 1 corresponding to a region with amino acids RPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PF4V1 Blocking Peptide, catalog no. 33R-8103, is also available for use as a blocking control in assays to test for specificity of this PF4V1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PF4V1

Target: PF4V1 (Platelet Factor 4 Variant 1 (PF4V1))

Alternative Name: PF4V1 (PF4V1 Products)

Synonyms: PF4A antibody, CXCL4L1 antibody, CXCL4V1 antibody, PF4-ALT antibody, SCYB4V1 antibody, PF4V1 antibody, platelet factor 4 variant 1 antibody, PF4V1 antibody

Background: PF4V1 is the inhibitor of angiogenesis. PF4V1 is the inhibitor of endothelial cell chemotaxis (in vitro).

Molecular Weight: 11 kDa (MW of target protein)