SHISA5 antibody (Middle Region)
-
- Target See all SHISA5 Antibodies
- SHISA5 (Shisa Homolog 5 (SHISA5))
-
Binding Specificity
- Middle Region
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SHISA5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SCOTIN antibody was raised against the middle region of Scotin
- Purification
- Affinity purified
- Immunogen
- SCOTIN antibody was raised using the middle region of Scotin corresponding to a region with amino acids CAVPEASVPASVEPVEQLGSALRFRPGYNDPMSGFGATLAVGLTIFVLSV
- Top Product
- Discover our top product SHISA5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SCOTIN Blocking Peptide, catalog no. 33R-1648, is also available for use as a blocking control in assays to test for specificity of this SCOTIN antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCOTIN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SHISA5 (Shisa Homolog 5 (SHISA5))
- Alternative Name
- SCOTIN (SHISA5 Products)
- Synonyms
- SCOTIN antibody, 2310008D10Rik antibody, 6430628I05Rik antibody, Scotin antibody, mShisa5 antibody, shisa family member 5 antibody, SHISA5 antibody, Shisa5 antibody
- Background
- This protein can induce apoptosis in a caspase-dependent manner and plays a role in p53/TP53-dependent apoptosis.
- Molecular Weight
- 25 kDa (MW of target protein)
-