SLC20A1 antibody

Catalog No. ABIN634562

Product Details anti-SLC20A1 Antibody

Target: SLC20A1 (Solute Carrier Family 20 (Phosphate Transporter), Member 1 (SLC20A1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC20A1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLC20 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC20A1 Blocking Peptide, catalog no. 33R-5497, is also available for use as a blocking control in assays to test for specificity of this SLC20A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC20A1

Target: SLC20A1 (Solute Carrier Family 20 (Phosphate Transporter), Member 1 (SLC20A1))

Alternative Name: SLC20A1 (SLC20A1 Products)

Synonyms: SLC20A1 antibody, DKFZp459N1424 antibody, Glvr-1 antibody, pit1 antibody, slc20a1 antibody, xSLC20A1 antibody, GLVR1 antibody, PIT1 antibody, PiT-1 antibody, AI607883 antibody, Glvr1 antibody, solute carrier family 20 member 1 antibody, solute carrier family 20 member 1 L homeolog antibody, solute carrier family 20, member 1 antibody, SLC20A1 antibody, slc20a1.L antibody, Slc20a1 antibody

Background: Retrovirus receptors allow infection of human and murine cells by various retroviruses. The receptors that have been identified at the molecular level include CD4 for human immunodeficiency virus, Rec1 for murine ecotropic virus, and GLVR1 for gibbon ape leukemia virus. These 3 proteins show no homology to one another at the DNA or protein level. GLVR1 is a sodium-dependent phosphate symporter.

Molecular Weight: 74 kDa (MW of target protein)