FcRn antibody (N-Term)

Catalog No. ABIN634564

Product Details anti-FcRn Antibody

Target: FcRn (IgG receptor FcRn (FcRn))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FcRn antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FCGRT antibody was raised against the N terminal of FCGRT

Purification: Affinity purified

Immunogen: FCGRT antibody was raised using the N terminal of FCGRT corresponding to a region with amino acids GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FCGRT Blocking Peptide, catalog no. 33R-3667, is also available for use as a blocking control in assays to test for specificity of this FCGRT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FCGRT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FcRn

Target: FcRn (IgG receptor FcRn (FcRn))

Alternative Name: FCGRT (FcRn Products)

Synonyms: FCRN antibody, alpha-chain antibody, FcRn antibody, Fc fragment of IgG receptor and transporter antibody, Fc receptor, IgG, alpha chain transporter antibody, FCGRT antibody, Fcgrt antibody

Background: FCGRT binds to the Fc region of monomeric immunoglobulins gamma. It mediates the uptake of IgG from milk. It plays a possible role in transfer of immunoglobulin G from mother to fetus.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process