ELMOD2 antibody (N-Term)

Catalog No. ABIN634597

Product Details anti-ELMOD2 Antibody

Target: ELMOD2 (ELMO/CED-12 Domain Containing 2 (ELMOD2))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ELMOD2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ELMOD2 antibody was raised against the N terminal of ELMOD2

Purification: Affinity purified

Immunogen: ELMOD2 antibody was raised using the N terminal of ELMOD2 corresponding to a region with amino acids FDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEVDKYVDDIMKEKNIN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ELMOD2 Blocking Peptide, catalog no. 33R-2873, is also available for use as a blocking control in assays to test for specificity of this ELMOD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELMOD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ELMOD2

Target: ELMOD2 (ELMO/CED-12 Domain Containing 2 (ELMOD2))

Alternative Name: ELMOD2 (ELMOD2 Products)

Synonyms: ELMOD2 antibody, 9830169G11Rik antibody, ELMO domain containing 2 antibody, ELMO/CED-12 domain containing 2 antibody, ELMOD2 antibody, Elmod2 antibody

Background: ELMOD2 is an engulfment and motility (ELMO) domain-containing protein.

Molecular Weight: 35 kDa (MW of target protein)