ARMC3 antibody (Middle Region)

Catalog No. ABIN634605

Product Details anti-ARMC3 Antibody

Target: ARMC3 (Armadillo Repeat Containing 3 (ARMC3))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARMC3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ARMC3 antibody was raised against the middle region of ARMC3

Purification: Affinity purified

Immunogen: ARMC3 antibody was raised using the middle region of ARMC3 corresponding to a region with amino acids YHFSAGFGSPIEDKSEPASGRNTVLSKSATKEKGWRKSKGKKEEEKVKEE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARMC3 Blocking Peptide, catalog no. 33R-10121, is also available for use as a blocking control in assays to test for specificity of this ARMC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARMC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARMC3

Target: ARMC3 (Armadillo Repeat Containing 3 (ARMC3))

Alternative Name: ARMC3 (ARMC3 Products)

Synonyms: 4921513G22Rik antibody, MGC76186 antibody, CT81 antibody, KU-CT-1 antibody, armadillo repeat containing 3 antibody, putative armc3 antibody, Armc3 antibody, armc3 antibody, ARMC3 antibody, Smp_105950 antibody

Background: Armadillo/beta-catenin like (ARM) domains are imperfect 45-amino acid repeats involved in protein-protein interactions. ARM domain-containing proteins, such as ARMC3, function in signal transduction, development, cell adhesion and mobility, and tumor initiation and metastasis.

Molecular Weight: 96 kDa (MW of target protein)