NPHP1 antibody

Catalog No. ABIN634609

Product Details anti-NPHP1 Antibody

Target: NPHP1 (Nephronophthisis 1 (Juvenile) (NPHP1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NPHP1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: NPHP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GILFELGISYIRNSTGERGELSCGWVFLKLFDASGVPIPAKTYELFLNGG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NPHP1 Blocking Peptide, catalog no. 33R-3334, is also available for use as a blocking control in assays to test for specificity of this NPHP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NPHP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NPHP1

Target: NPHP1 (Nephronophthisis 1 (Juvenile) (NPHP1))

Alternative Name: NPHP1 (NPHP1 Products)

Synonyms: JBTS4 antibody, NPH1 antibody, SLSN1 antibody, nephrocystin-1 antibody, NPHP1 antibody, im:7162391 antibody, wu:fi59g07 antibody, zgc:152930 antibody, Nphp1 antibody, nephrocystin 1 antibody, nephronophthisis 1 (juvenile) homolog (human) antibody, nephronophthisis 1 (juvenile) L homeolog antibody, nephronophthisis 1 antibody, nephrocystin-1 antibody, NPHP1 antibody, Nphp1 antibody, nphp1.L antibody, nphp1 antibody, LOC100725987 antibody

Background: Together with Cas NPHP1 may play a role in the control of epithelial cell polarity. NPHP1 seems to help to recruit protein tyrosine kinase 2 beta (PTK2B) to cell matrix adhesions, thereby initiating phosphorylation of PTK2B and PTK2B-dependent signaling.

Molecular Weight: 83 kDa (MW of target protein)