MYBPC2 antibody (N-Term)
-
- Target See all MYBPC2 Antibodies
- MYBPC2 (Myosin Binding Protein C, Fast Type (MYBPC2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MYBPC2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MYBPC2 antibody was raised against the N terminal of MYBPC2
- Purification
- Affinity purified
- Immunogen
- MYBPC2 antibody was raised using the N terminal of MYBPC2 corresponding to a region with amino acids KEAPPEDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPT
- Top Product
- Discover our top product MYBPC2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MYBPC2 Blocking Peptide, catalog no. 33R-4316, is also available for use as a blocking control in assays to test for specificity of this MYBPC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYBPC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MYBPC2 (Myosin Binding Protein C, Fast Type (MYBPC2))
- Alternative Name
- MYBPC2 (MYBPC2 Products)
- Synonyms
- MYBPC antibody, MYBPCF antibody, im:7137115 antibody, im:7150089 antibody, zgc:110761 antibody, myosin binding protein C, fast-type antibody, myosin binding protein C, fast type antibody, myosin-binding protein C, fast-type antibody, myosin binding protein C, fast type b antibody, Mybpc2 antibody, MYBPC2 antibody, LOC520988 antibody, mybpc2b antibody
- Background
- MYBPC2 encodes a member of the myosin-binding protein family C family. Myosin-binding protein C is a myosin-associated protein found in the cross-bridge-bearing zone (C region) of A bands in striated muscle. Mutations in this gene have been associated with hypertrophic cardiomyopathy.
- Molecular Weight
- 128 kDa (MW of target protein)
-