SLIT3 antibody

Catalog No. ABIN634630

Product Details anti-SLIT3 Antibody

Target: SLIT3 (Slit Homolog 3 (SLIT3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLIT3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLIT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLIT3 Blocking Peptide, catalog no. 33R-7343, is also available for use as a blocking control in assays to test for specificity of this SLIT3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLIT3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLIT3

Target: SLIT3 (Slit Homolog 3 (SLIT3))

Alternative Name: SLIT3 (SLIT3 Products)

Synonyms: MGC146100 antibody, zgc:111911 antibody, MEGF5 antibody, SLIL2 antibody, SLIT1 antibody, Slit-3 antibody, slit2 antibody, Slil2 antibody, Slit1 antibody, Megf5 antibody, slit guidance ligand 3 antibody, slit homolog 3 (Drosophila) antibody, Slit3 antibody, slit3 antibody, SLIT3 antibody, LOC100125612 antibody, Slit3 antibody

Background: SLIT3 may act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors.

Molecular Weight: 168 kDa (MW of target protein)

Pathways: Regulation of Cell Size