HAPLN1 antibody (N-Term)

Catalog No. ABIN634638

Product Details anti-HAPLN1 Antibody

Target: HAPLN1 (Hyaluronan and Proteoglycan Link Protein 1 (HAPLN1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HAPLN1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HAPLN1 antibody was raised against the N terminal of HAPLN1

Purification: Affinity purified

Immunogen: HAPLN1 antibody was raised using the N terminal of HAPLN1 corresponding to a region with amino acids ENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HAPLN1 Blocking Peptide, catalog no. 33R-2605, is also available for use as a blocking control in assays to test for specificity of this HAPLN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAPLN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HAPLN1

Target: HAPLN1 (Hyaluronan and Proteoglycan Link Protein 1 (HAPLN1))

Alternative Name: HAPLN1 (HAPLN1 Products)

Synonyms: crtl1 antibody, hapln1 antibody, wu:fc26f11 antibody, wu:fc37g04 antibody, wu:fc50e12 antibody, wu:fc55h01 antibody, CRTL1 antibody, LP antibody, BB099155 antibody, CLP antibody, Crtl1 antibody, Crtl1l antibody, LP-1 antibody, CTRL1 antibody, hyaluronan and proteoglycan link protein 1 antibody, hyaluronan and proteoglycan link protein 1a antibody, HAPLN1 antibody, hapln1a antibody, Hapln1 antibody

Background: HAPLN1 stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix.

Molecular Weight: 40 kDa (MW of target protein)